CALL US

Tel: 042-581-8448 | Fax: 042-581-8449

EMAIL US
OPENING HOURS

Mon - Fri: 9am - 6pm

OVER 20 YEARS EXPERIENCE

- Since 1999

OUR SERVICES

- Recombinant Antibody Screening 

- Recombinant Antibody Purification

VISIT US

More than 400 specialized products for molecular biology and protein biochemistry

  • Facebook Social Icon
  • Twitter Social Icon
  • Google+ Social Icon
  • YouTube Social  Icon
  • Pinterest Social Icon
  • Instagram Social Icon

© 2018 by ELPISBIOTECH. INC

RECOMBINANT ANTIBODIES /
CANCER STUDY

재조합 항체 스크리닝의 대표브랜드 

CD23
Anti-
1/1
1/1
1/1

Antibody Format :

sdAb

Fusion Protein :

GB1

Antigen :

Low affinity immunoglobulin epsilon Fc receptor

UniProtKB :

P06734

Species :

HUMAN

Species Cross-reactivity :

Remarks :

Applications : Dilution

  • ELISA

  • WB

  • IF

_

_

Description :

  • Antigen Preparation : 

The 30.9 kDa extracellular human protein domain (48-321 aa) was expressed in E.coli and purified by his affinity purification.

  • Antigen Amino Acid Sequence : 

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

​Abbrevications and cautions :

  • scFv : human single chain antibody (naive sequences)

  • sdAb : camel single domain antibody (fully synthetic sequences)

  • GB1 fusion : IgG binding domain of streptococcal protein G

  • IgG Fc fusion : human, mouse or rabbit IgG Fc (contains hinge, CH1, CH2 domain)

  • Applications : yes/no or _ (not determined)